PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0252429.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family LBD
Protein Properties Length: 93aa    MW: 10472 Da    PI: 9.4864
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0252429.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26067.82.4e-211192182
           DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilk 82
                     +C  Ck +r++C  dC + + fp+++  +f n+   FG sn+l+ lka++++er +++ s++ e+ +r +dPv+G +gv+l+
  Lj0g3v0252429.1 11 PCILCKRQRKTCHGDCEFGQFFPSNRYGEFDNACSHFGLSNILHNLKAVQPHERLATAGSILIEGTIRRNDPVRGGLGVVLD 92
                     799***************************************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089117.6441093IPR004883Lateral organ boundaries, LOB
PfamPF031954.5E-201193IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MNRRRIKGSY PCILCKRQRK TCHGDCEFGQ FFPSNRYGEF DNACSHFGLS NILHNLKAVQ  60
PHERLATAGS ILIEGTIRRN DPVRGGLGVV LDL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A067E2B91e-23A0A067E2B9_CITSI; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144321117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G19820.12e-20LOB domain-containing protein 9